"FZD7" Related Products

Expand
Expand

Recombinant Human FZD7

Cat.No.: FZD7-26288TH
Product Overview: Recombinant fragment of Human Frizzled 7 with a proprietary tag: predicted molecular weight 36.52 kDa.
Description: Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Tissue specificity: High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas.
Biological activity: This product is useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFA
Sequence Similarities: Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.
Gene Name: FZD7 frizzled family receptor 7 [ Homo sapiens ]
Official Symbol: FZD7
Synonyms: FZD7; frizzled family receptor 7; frizzled (Drosophila) homolog 7 , frizzled 7, seven transmembrane spanning receptor , frizzled homolog 7 (Drosophila); frizzled-7; FzE3;
Gene ID: 8324
mRNA Refseq: NM_003507
Protein Refseq: NP_003498
MIM: 603410
Uniprot ID: O75084
Chromosome Location: 2q33
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem;
Function: G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.