"GABBR1" Related Products

Expand
Expand

Recombinant Human GABBR1

Cat.No.: GABBR1-28091TH
Product Overview: Recombinant fragment corresponding to amino acids 52-151 of Human GABA B Receptor 1 with a proprietary tag; Predicted MWt 36.63 kDa.
Description: Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa
Source: Wheat germ
Tissue specificity: Highly expressed in brain and weakly in heart, small intestine and uterus. Isoform 1A is mostly expressed in granular cell and molecular layer. Isoform 1B is mostly expressed in Purkinje cells. Isoform 1E is predominantly expressed in peripheral tissues a
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
Sequence Similarities: Belongs to the G-protein coupled receptor 3 family. GABA-B receptor subfamily.Contains 2 Sushi (CCP/SCR) domains.
Gene Name: GABBR1 gamma-aminobutyric acid (GABA) B receptor, 1 [ Homo sapiens ]
Official Symbol: GABBR1
Synonyms: GABBR1; gamma-aminobutyric acid (GABA) B receptor, 1; gamma-aminobutyric acid type B receptor subunit 1; GABA B receptor; GPRC3A; hGB1a;
Gene ID: 2550
mRNA Refseq: NM_001470
Protein Refseq: NP_001461
MIM: 603540
Uniprot ID: Q9UBS5
Chromosome Location: 6p21.3
Pathway: Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem;
Function: G-protein coupled receptor activity; GABA-B receptor activity; protein binding; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.