Recombinant Human GABBR1

Cat.No. : GABBR1-28091TH
Product Overview : Recombinant fragment corresponding to amino acids 52-151 of Human GABA B Receptor 1 with a proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system.
Molecular Weight : 36.630kDa
Tissue specificity : Highly expressed in brain and weakly in heart, small intestine and uterus. Isoform 1A is mostly expressed in granular cell and molecular layer. Isoform 1B is mostly expressed in Purkinje cells. Isoform 1E is predominantly expressed in peripheral tissues a
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
Sequence Similarities : Belongs to the G-protein coupled receptor 3 family. GABA-B receptor subfamily.Contains 2 Sushi (CCP/SCR) domains.
Gene Name GABBR1 gamma-aminobutyric acid (GABA) B receptor, 1 [ Homo sapiens ]
Official Symbol GABBR1
Synonyms GABBR1; gamma-aminobutyric acid (GABA) B receptor, 1; gamma-aminobutyric acid type B receptor subunit 1; GABA B receptor; GPRC3A; hGB1a;
Gene ID 2550
mRNA Refseq NM_001470
Protein Refseq NP_001461
MIM 603540
Uniprot ID Q9UBS5
Chromosome Location 6p21.3
Pathway Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem;
Function G-protein coupled receptor activity; GABA-B receptor activity; protein binding; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GABBR1 Products

Required fields are marked with *

My Review for All GABBR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon