Recombinant Human GABBR1
Cat.No. : | GABBR1-28091TH |
Product Overview : | Recombinant fragment corresponding to amino acids 52-151 of Human GABA B Receptor 1 with a proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. |
Molecular Weight : | 36.630kDa |
Tissue specificity : | Highly expressed in brain and weakly in heart, small intestine and uterus. Isoform 1A is mostly expressed in granular cell and molecular layer. Isoform 1B is mostly expressed in Purkinje cells. Isoform 1E is predominantly expressed in peripheral tissues a |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG |
Sequence Similarities : | Belongs to the G-protein coupled receptor 3 family. GABA-B receptor subfamily.Contains 2 Sushi (CCP/SCR) domains. |
Gene Name | GABBR1 gamma-aminobutyric acid (GABA) B receptor, 1 [ Homo sapiens ] |
Official Symbol | GABBR1 |
Synonyms | GABBR1; gamma-aminobutyric acid (GABA) B receptor, 1; gamma-aminobutyric acid type B receptor subunit 1; GABA B receptor; GPRC3A; hGB1a; |
Gene ID | 2550 |
mRNA Refseq | NM_001470 |
Protein Refseq | NP_001461 |
MIM | 603540 |
Uniprot ID | Q9UBS5 |
Chromosome Location | 6p21.3 |
Pathway | Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Class C/3 (Metabotropic glutamate/pheromone receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; |
Function | G-protein coupled receptor activity; GABA-B receptor activity; protein binding; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GABBR1-8161H | Recombinant Human GABBR1 protein, His & T7-tagged | +Inquiry |
GABBR1-5162HF | Recombinant Full Length Human GABBR1 Protein, GST-tagged | +Inquiry |
GABBR1-1116HFL | Recombinant Human GABBR1 protein, His&Flag-tagged | +Inquiry |
GABBR1-3424M | Recombinant Mouse GABBR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GABBR1-6141M | Recombinant Mouse GABBR1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GABBR1-6073HCL | Recombinant Human GABBR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GABBR1 Products
Required fields are marked with *
My Review for All GABBR1 Products
Required fields are marked with *
0
Inquiry Basket