"GATA3" Related Products

Expand
Expand
Expand

Recombinant Human GATA3

Cat.No.: GATA3-28477TH
Product Overview: Recombinant fragment corresponding to amino acids 103-200 of Human GATA3 with a proprietary tag; Predicted MWt 36.41 kDa.
Description: This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa
Source: Wheat germ
Tissue specificity: T-cells and endothelial cells.
Biological activity: useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
Sequence Similarities: Contains 2 GATA-type zinc fingers.
Gene Name: GATA3 GATA binding protein 3 [ Homo sapiens ]
Official Symbol: GATA3
Synonyms: GATA3; GATA binding protein 3; trans-acting T-cell-specific transcription factor GATA-3; HDR;
Gene ID: 2625
mRNA Refseq: NM_001002295
Protein Refseq: NP_001002295
MIM: 131320
Uniprot ID: P23771
Chromosome Location: 10p15
Pathway: Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem;
Function: DNA binding; E-box binding; HMG box domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; core promoter proximal region sequence-specif;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.