Recombinant Human GHRHR

• Cat.No.: GHRHR-29025TH
• Product Overview: Recombinant fragment of Human GHRHR (amino acids 23-132) with N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag.

Specification

• Description: This gene encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Pituitary gland.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGL LCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWS EPFPPYPVACPVPLELLAEEESYFSTVKII
• Sequence Similarities: Belongs to the G-protein coupled receptor 2 family.

Gene Information

• Gene Name: GHRHR growth hormone releasing hormone receptor [ Homo sapiens ]
• Official Symbol: GHRHR
• Synonyms: GHRHR; growth hormone releasing hormone receptor; growth hormone-releasing hormone receptor
• Gene ID: 2692
• mRNA Refseq: NM_000823
• Protein Refseq: NP_000814
• MIM: 139191
• Uniprot ID: Q02643
• Chromosome Location: 7p14
• Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem
• Function: G-protein coupled receptor activity; growth factor binding; growth hormone-releasing hormone receptor activity; growth hormone-releasing hormone receptor activity; peptide hormone binding