Recombinant Human GNPNAT1, His-tagged

• Cat.No.: GNPNAT1-26420TH
• Product Overview: Recombinant full length Human GNPNAT1 with an N terminal His tag; 207 amino acids with tag, Predicted MWt 23.1 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 184 amino acids
• Conjugation: HIS
• Molecular Weight: 23.100kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
• Sequence Similarities: Belongs to the acetyltransferase family. GNA1 subfamily.Contains 1 N-acetyltransferase domain.

Gene Information

• Gene Name: GNPNAT1 glucosamine-phosphate N-acetyltransferase 1 [ Homo sapiens ]
• Official Symbol: GNPNAT1
• Synonyms: GNPNAT1; glucosamine-phosphate N-acetyltransferase 1; glucosamine 6-phosphate N-acetyltransferase; FLJ10607; Gpnat1
• Gene ID: 64841
• mRNA Refseq: NM_198066
• Protein Refseq: NP_932332
• Uniprot ID: Q96EK6
• Chromosome Location: 14q22.1
• Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem
• Function: glucosamine 6-phosphate N-acetyltransferase activity; monosaccharide binding; transferase activity, transferring acyl groups