"GNPNAT1" Related Products

Expand
Expand

Recombinant Human GNPNAT1, His-tagged

Cat.No.: GNPNAT1-26420TH
Product Overview: Recombinant full length Human GNPNAT1 with an N terminal His tag; 207 amino acids with tag, Predicted MWt 23.1 kDa.
Protein length: 184 amino acids
Conjugation: HIS
Molecular Weight: 23.100kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK
Sequence Similarities: Belongs to the acetyltransferase family. GNA1 subfamily.Contains 1 N-acetyltransferase domain.
Gene Name: GNPNAT1 glucosamine-phosphate N-acetyltransferase 1 [ Homo sapiens ]
Official Symbol: GNPNAT1
Synonyms: GNPNAT1; glucosamine-phosphate N-acetyltransferase 1; glucosamine 6-phosphate N-acetyltransferase; FLJ10607; Gpnat1;
Gene ID: 64841
mRNA Refseq: NM_198066
Protein Refseq: NP_932332
Uniprot ID: Q96EK6
Chromosome Location: 14q22.1
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem;
Function: glucosamine 6-phosphate N-acetyltransferase activity; monosaccharide binding; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.