Recombinant Human GNPNAT1, His-tagged
Cat.No. : | GNPNAT1-26420TH |
Product Overview : | Recombinant full length Human GNPNAT1 with an N terminal His tag; 207 amino acids with tag, Predicted MWt 23.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 184 amino acids |
Conjugation : | HIS |
Molecular Weight : | 23.100kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK |
Sequence Similarities : | Belongs to the acetyltransferase family. GNA1 subfamily.Contains 1 N-acetyltransferase domain. |
Gene Name | GNPNAT1 glucosamine-phosphate N-acetyltransferase 1 [ Homo sapiens ] |
Official Symbol | GNPNAT1 |
Synonyms | GNPNAT1; glucosamine-phosphate N-acetyltransferase 1; glucosamine 6-phosphate N-acetyltransferase; FLJ10607; Gpnat1; |
Gene ID | 64841 |
mRNA Refseq | NM_198066 |
Protein Refseq | NP_932332 |
Uniprot ID | Q96EK6 |
Chromosome Location | 14q22.1 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; |
Function | glucosamine 6-phosphate N-acetyltransferase activity; monosaccharide binding; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
GNPNAT1-7052M | Recombinant Mouse GNPNAT1 Protein | +Inquiry |
GNPNAT1-2989Z | Recombinant Zebrafish GNPNAT1 | +Inquiry |
GNPNAT1-933H | Recombinant Human GNPNAT1, His-tagged | +Inquiry |
GNPNAT1-1914R | Recombinant Rhesus monkey GNPNAT1 Protein, His-tagged | +Inquiry |
GNPNAT1-3784M | Recombinant Mouse GNPNAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPNAT1-5841HCL | Recombinant Human GNPNAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNPNAT1 Products
Required fields are marked with *
My Review for All GNPNAT1 Products
Required fields are marked with *