Recombinant Human GOLPH3

• Cat.No.: GOLPH3-26785TH
• Product Overview: Recombinant full length Human GOLPH3 with proprietary tag; Predicted MWt 58.85 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 298 amino acids
• Description: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.
• Molecular Weight: 58.850kDa inclusive of tags
• Tissue specificity: Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
• Sequence Similarities: Belongs to the GOLPH3/VPS74 family.

Gene Information

• Gene Name: GOLPH3 golgi phosphoprotein 3 (coat-protein) [ Homo sapiens ]
• Official Symbol: GOLPH3
• Synonyms: GOLPH3; golgi phosphoprotein 3 (coat-protein); Golgi phosphoprotein 3; coat protein; golgi peripheral membrane protein 1; 34 kDa; golgi protein; golgi associated protein; GOPP1; GPP34; MIDAS
• Gene ID: 64083
• mRNA Refseq: NM_022130
• Protein Refseq: NP_071413
• MIM: 612207
• Uniprot ID: Q9H4A6
• Chromosome Location: 5p13.2
• Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; lysine fermentation to acetate and butyrate, organism-specific biosystem; superpathway of lysine degradation, organism-specific biosystem
• Function: protein binding