"GPR12" Related Products

Expand

Recombinant Human GPR12

Cat.No.: GPR12-29093TH
Product Overview: Recombinant full length Human GPCR GPR12 with N terminal proprietary tag; Predicted MWt 62.81 kDa.
Protein length: 334 amino acids
Molecular Weight: 62.810kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEP ELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMF LLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVM LVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAA ILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPS IYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCI PSSLAQRARSPSDV
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: GPR12 G protein-coupled receptor 12 [ Homo sapiens ]
Official Symbol: GPR12
Synonyms: GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21;
Gene ID: 2835
mRNA Refseq: NM_005288
Protein Refseq: NP_005279
MIM: 600752
Uniprot ID: P47775
Chromosome Location: 13q12
Pathway: GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function: G-protein coupled receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.