Recombinant Full Length Human GPR12 Protein
Cat.No. : | GPR12-202HF |
Product Overview : | Recombinant full length Human GPCR GPR12 with N terminal proprietary tag; Predicted MWt 62.81 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 334 amino acids |
Description : | Predicted to enable G protein-coupled receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of metabolic process. Predicted to act upstream of or within G protein-coupled receptor signaling pathway and cellular calcium ion homeostasis. Predicted to be integral component of plasma membrane. Predicted to be active in cytoplasm and plasma membrane. |
Form : | Liquid |
Molecular Mass : | 62.810kDa inclusive of tags |
AA Sequence : | MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEP ELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMF LLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVM LVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAA ILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPS IYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCI PSSLAQRARSPSDV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GPR12 G protein-coupled receptor 12 [ Homo sapiens ] |
Official Symbol | GPR12 |
Synonyms | GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21 |
Gene ID | 2835 |
mRNA Refseq | NM_005288 |
Protein Refseq | NP_005279 |
MIM | 600752 |
UniProt ID | P47775 |
◆ Recombinant Proteins | ||
RFL2664HF | Recombinant Full Length Human G-Protein Coupled Receptor 12(Gpr12) Protein, His-Tagged | +Inquiry |
RFL3488MF | Recombinant Full Length Mouse G-Protein Coupled Receptor 12(Gpr12) Protein, His-Tagged | +Inquiry |
GPR12-5614HF | Recombinant Full Length Human GPR12 Protein, GST-tagged | +Inquiry |
GPR12-202HF | Recombinant Full Length Human GPR12 Protein | +Inquiry |
GPR12-2649R | Recombinant Rat GPR12 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR12 Products
Required fields are marked with *
My Review for All GPR12 Products
Required fields are marked with *