Recombinant Full Length Human GPR12 Protein
Cat.No. : | GPR12-202HF |
Product Overview : | Recombinant full length Human GPCR GPR12 with N terminal proprietary tag; Predicted MWt 62.81 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Predicted to enable G protein-coupled receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of metabolic process. Predicted to act upstream of or within G protein-coupled receptor signaling pathway and cellular calcium ion homeostasis. Predicted to be integral component of plasma membrane. Predicted to be active in cytoplasm and plasma membrane. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 62.810kDa inclusive of tags |
Protein Length : | 334 amino acids |
AA Sequence : | MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEP ELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMF LLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVM LVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAA ILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPS IYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCI PSSLAQRARSPSDV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | GPR12 G protein-coupled receptor 12 [ Homo sapiens ] |
Official Symbol : | GPR12 |
Synonyms : | GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21 |
Gene ID : | 2835 |
mRNA Refseq : | NM_005288 |
Protein Refseq : | NP_005279 |
MIM : | 600752 |
UniProt ID : | P47775 |
Products Types
◆ Recombinant Protein | ||
GPR12-3843M | Recombinant Mouse GPR12 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR12-5178H | Recombinant Human GPR12 Protein, GST-tagged | +Inquiry |
GPR12-2303R | Recombinant Rat GPR12 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR12-29093TH | Recombinant Human GPR12 | +Inquiry |
GPR12-7133M | Recombinant Mouse GPR12 Protein | +Inquiry |
◆ Assay kits | ||
Kit-1278 | GPR12 CHO-K1 β-Arrestin Orphan GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket