"GPT" Related Products

Expand
Expand

Recombinant Human GPT, His-tagged

Cat.No.: GPT-26390TH
Product Overview: Recombinant full-length Human Alanine Transaminase with a N terminal His tag. 516 amino acids with a predicted MWt 56.8 kDa including tag.
Description: This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.
Protein length: 496 amino acids
Conjugation: HIS
Molecular Weight: 56.800kDa inclusive of tags
Source: E. coli
Tissue specificity: Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASSTGDRSQAVRHGLRAKV LTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKK PFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSP NFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDV ARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEG HTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAW ALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTREC IEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKV LMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNM DAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDP SFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQG AMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETG ICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFH AKFTLEYS
Sequence Similarities: Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.
Gene Name: GPT glutamic-pyruvate transaminase (alanine aminotransferase) [ Homo sapiens ]
Official Symbol: GPT
Synonyms: GPT; glutamic-pyruvate transaminase (alanine aminotransferase); alanine aminotransferase 1; ALT1; GPT1;
Gene ID: 2875
mRNA Refseq: NM_005309
Protein Refseq: NP_005300
MIM: 138200
Uniprot ID: P24298
Chromosome Location: 8q24.2-qter
Pathway: Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Amino acid synthesis and interconversion (transamination), organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function: 1-aminocyclopropane-1-carboxylate synthase activity; L-alanine:2-oxoglutarate aminotransferase activity; L-alanine:2-oxoglutarate aminotransferase activity; pyridoxal phosphate binding; transaminase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.