Recombinant Human GPT, His-tagged GPT-26390TH

Recombinant Human GPT, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GPT, His-tagged

Recombinant Human GPT, His-tagged

GPT Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GPT-26390TH
Product Overview : Recombinant full-length Human Alanine Transaminase with a N terminal His tag. 516 amino acids with a predicted MWt 56.8 kDa including tag.
Description : This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.
Protein length : 496 amino acids
Conjugation : HIS
Molecular Weight : 56.800kDa inclusive of tags
Source : E. coli
Tissue specificity : Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.03% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASSTGDRSQAVRHGLRAKV LTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKK PFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSP NFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDV ARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEG HTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAW ALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTREC IEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKV LMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNM DAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDP SFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQG AMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETG ICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFH AKFTLEYS
Sequence Similarities : Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.
Gene Name : GPT glutamic-pyruvate transaminase (alanine aminotransferase) [ Homo sapiens ]
Official Symbol : GPT
Synonyms : GPT; glutamic-pyruvate transaminase (alanine aminotransferase); alanine aminotransferase 1; ALT1; GPT1;
Gene ID : 2875
mRNA Refseq : NM_005309
Protein Refseq : NP_005300
MIM : 138200
Uniprot ID : P24298
Chromosome Location : 8q24.2-qter
Pathway : Alanine and aspartate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Amino acid synthesis and interconversion (transamination), organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function : 1-aminocyclopropane-1-carboxylate synthase activity; L-alanine:2-oxoglutarate aminotransferase activity; L-alanine:2-oxoglutarate aminotransferase activity; pyridoxal phosphate binding; transaminase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy