Recombinant Human GPT protein, His-tagged
| Cat.No. : | GPT-2493H |
| Product Overview : | Recombinant Human GPT protein(146-496 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 146-496 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEYS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GPT glutamic-pyruvate transaminase (alanine aminotransferase) [ Homo sapiens ] |
| Official Symbol | GPT |
| Synonyms | GPT; glutamic-pyruvate transaminase (alanine aminotransferase); alanine aminotransferase 1; ALT1; GPT1; GPT 1; glutamic-alanine transaminase 1; glutamic--alanine transaminase 1; glutamic--pyruvic transaminase 1; glutamate pyruvate transaminase 1; AAT1; |
| Gene ID | 2875 |
| mRNA Refseq | NM_005309 |
| Protein Refseq | NP_005300 |
| MIM | 138200 |
| UniProt ID | P24298 |
| ◆ Recombinant Proteins | ||
| Gpt-5809M | Recombinant Mouse Gpt protein, His-tagged | +Inquiry |
| GPT-1785R | Recombinant Rhesus Macaque GPT Protein, His (Fc)-Avi-tagged | +Inquiry |
| GPT-26390TH | Recombinant Human GPT, His-tagged | +Inquiry |
| GPT-2236H | Recombinant Human GPT Protein, MYC/DDK-tagged | +Inquiry |
| GPT-4845H | Recombinant Human GPT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Native Proteins | ||
| GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
| GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
| GPT-26879TH | Native Human GPT | +Inquiry |
| GPT-1840H | Active Native Human GPT | +Inquiry |
| GPT-26882TH | Native Human GPT | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPT-721RCL | Recombinant Rat GPT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPT Products
Required fields are marked with *
My Review for All GPT Products
Required fields are marked with *
