Recombinant Human GRIK4

• Cat.No.: GRIK4-29879TH
• Product Overview: Recombinant fragment of Human KA1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.
• Molecular Weight: 37.730kDa
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSS PASSSIISNICGEKEVPHFKVAPEEFVKFQ
• Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK4 subfamily.

Gene Information

• Gene Name: GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ]
• Official Symbol: GRIK4
• Synonyms: GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; KA1
• Gene ID: 2900
• mRNA Refseq: NM_014619
• Protein Refseq: NP_055434
• MIM: 600282
• Uniprot ID: Q16099
• Chromosome Location: 11q
• Pathway: Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Ionotropic activity of Kainate Receptors, organism-specific biosystem
• Function: extracellular-glutamate-gated ion channel activity; ion channel activity; kainate selective glutamate receptor activity; receptor activity