"GRIK4" Related Products

Recombinant Human GRIK4

Cat.No.: GRIK4-29879TH
Product Overview: Recombinant fragment of Human KA1 with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag.
Description: This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSS PASSSIISNICGEKEVPHFKVAPEEFVKFQ
Sequence Similarities: Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK4 subfamily.
Gene Name: GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ]
Official Symbol: GRIK4
Synonyms: GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; KA1;
Gene ID: 2900
mRNA Refseq: NM_014619
Protein Refseq: NP_055434
MIM: 600282
Uniprot ID: Q16099
Chromosome Location: 11q
Pathway: Activation of Ca-permeable Kainate Receptor, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; Glutamatergic synapse, organism-specific biosystem; Glutamatergic synapse, conserved biosystem; Ionotropic activity of Kainate Receptors, organism-specific biosystem;
Function: extracellular-glutamate-gated ion channel activity; ion channel activity; kainate selective glutamate receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.