Recombinant Human GSTA4, GST-tagged

• Cat.No.: GSTA4-27771TH
• Product Overview: Recombinant full length Human GSTA4 with N terminal proprietary tag. Predicted MW 50.16 kDa.

Specification

• Description: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinsons disease, Alzheimers disease, cataract formation, and atherosclerosis.
• Protein length: 222 amino acids
• Conjugation: GST
• Molecular Weight: 50.160kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQ LYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHN LFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVIL LQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEP GSKKKPPPDEIYVRTVYNIFRP
• Sequence Similarities: Belongs to the GST superfamily. Alpha family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.

Gene Information

• Gene Name: GSTA4 glutathione S-transferase alpha 4 [ Homo sapiens ]
• Official Symbol: GSTA4
• Synonyms: GSTA4; glutathione S-transferase alpha 4; glutathione S transferase A4; glutathione S-transferase A4
• Gene ID: 2941
• mRNA Refseq: NM_001512
• Protein Refseq: NP_001503
• MIM: 605450
• Uniprot ID: O15217
• Chromosome Location: 6p12.2
• Pathway: Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem
• Function: glutathione transferase activity; glutathione transferase activity; glutathione transferase activity; protein homodimerization activity; transferase activity