"HES1" Related Products

Expand

Recombinant Human HES1

Cat.No.: HES1-26539TH
Product Overview: Recombinant fragment corresponding to amino acids 201-280 of Human Hes1 with a proprietary tag; Predicted MWt 34.91 kDa.
Description: This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
Protein length: 80 amino acids
Molecular Weight: 34.910kDa inclusive of tags
Source: Wheat germ
Biological activity: useful for Antibody Production and Protein Array
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain.
Gene Name: HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ]
Official Symbol: HES1
Synonyms: HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1;
Gene ID: 3280
mRNA Refseq: NM_005524
Protein Refseq: NP_005515
MIM: 139605
Uniprot ID: Q14469
Chromosome Location: 3q28-q29
Pathway: ATF-2 transcription factor network, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem;
Function: DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.