Recombinant Human HNF4G
| Cat.No. : | HNF4G-29372TH |
| Product Overview : | Recombinant fragment of Human HNF4 gamma with N terminal proprietary tag; Predicted MW 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 98 amino acids |
| Molecular Weight : | 36.410kDa inclusive of tags |
| Tissue specificity : | Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ |
| Sequence Similarities : | Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain. |
| Gene Name | HNF4G hepatocyte nuclear factor 4, gamma [ Homo sapiens ] |
| Official Symbol | HNF4G |
| Synonyms | HNF4G; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; NR2A2; |
| Gene ID | 3174 |
| mRNA Refseq | NM_004133 |
| Protein Refseq | NP_004124 |
| MIM | 605966 |
| Uniprot ID | Q14541 |
| Chromosome Location | 8q21-q22 |
| Pathway | Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; |
| Function | metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; |
| ◆ Recombinant Proteins | ||
| HNF4G-2561H | Recombinant Human HNF4G protein, His-tagged | +Inquiry |
| HNF4G-29372TH | Recombinant Human HNF4G | +Inquiry |
| HNF4G-4458Z | Recombinant Zebrafish HNF4G | +Inquiry |
| HNF4G-301151H | Recombinant Human HNF4G protein, GST-tagged | +Inquiry |
| HNF4G-4897H | Recombinant Human HNF4G Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNF4G-333HCL | Recombinant Human HNF4G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNF4G Products
Required fields are marked with *
My Review for All HNF4G Products
Required fields are marked with *



