Recombinant Human HNF4G

Cat.No. : HNF4G-29372TH
Product Overview : Recombinant fragment of Human HNF4 gamma with N terminal proprietary tag; Predicted MW 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
Sequence Similarities : Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name HNF4G hepatocyte nuclear factor 4, gamma [ Homo sapiens ]
Official Symbol HNF4G
Synonyms HNF4G; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; NR2A2;
Gene ID 3174
mRNA Refseq NM_004133
Protein Refseq NP_004124
MIM 605966
Uniprot ID Q14541
Chromosome Location 8q21-q22
Pathway Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem;
Function metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNF4G Products

Required fields are marked with *

My Review for All HNF4G Products

Required fields are marked with *

0
cart-icon
0
compare icon