Recombinant Human HNF4G protein, His-tagged
Cat.No. : | HNF4G-2561H |
Product Overview : | Recombinant Human HNF4G protein(327-408 aa), fused to His tag, was expressed in E. coli. |
Availability | August 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 327-408 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HNF4G hepatocyte nuclear factor 4, gamma [ Homo sapiens ] |
Official Symbol | HNF4G |
Synonyms | HNF4G; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; NR2A2; HNF-4-gamma; nuclear receptor subfamily 2 group A member 2; NR2A3; |
Gene ID | 3174 |
mRNA Refseq | NM_004133 |
Protein Refseq | NP_004124 |
MIM | 605966 |
UniProt ID | Q14541 |
◆ Recombinant Proteins | ||
HNF4G-4897H | Recombinant Human HNF4G Protein, GST-tagged | +Inquiry |
HNF4G-4458Z | Recombinant Zebrafish HNF4G | +Inquiry |
HNF4G-301151H | Recombinant Human HNF4G protein, GST-tagged | +Inquiry |
HNF4G-29372TH | Recombinant Human HNF4G | +Inquiry |
HNF4G-2561H | Recombinant Human HNF4G protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNF4G-333HCL | Recombinant Human HNF4G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNF4G Products
Required fields are marked with *
My Review for All HNF4G Products
Required fields are marked with *