Recombinant Human HNF4G
Cat.No. : | HNF4G-29372TH |
Product Overview : | Recombinant fragment of Human HNF4 gamma with N terminal proprietary tag; Predicted MW 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ |
Sequence Similarities : | Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain. |
Gene Name | HNF4G hepatocyte nuclear factor 4, gamma [ Homo sapiens ] |
Official Symbol | HNF4G |
Synonyms | HNF4G; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; NR2A2; |
Gene ID | 3174 |
mRNA Refseq | NM_004133 |
Protein Refseq | NP_004124 |
MIM | 605966 |
Uniprot ID | Q14541 |
Chromosome Location | 8q21-q22 |
Pathway | Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; |
Function | metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; |
◆ Recombinant Proteins | ||
HNF4G-4458Z | Recombinant Zebrafish HNF4G | +Inquiry |
HNF4G-2561H | Recombinant Human HNF4G protein, His-tagged | +Inquiry |
HNF4G-29372TH | Recombinant Human HNF4G | +Inquiry |
HNF4G-301151H | Recombinant Human HNF4G protein, GST-tagged | +Inquiry |
HNF4G-4897H | Recombinant Human HNF4G Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNF4G-333HCL | Recombinant Human HNF4G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNF4G Products
Required fields are marked with *
My Review for All HNF4G Products
Required fields are marked with *
0
Inquiry Basket