Recombinant Human HNF4G protein, GST-tagged
Cat.No. : | HNF4G-301151H |
Product Overview : | Recombinant Human HNF4G protein(327-408 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 327-408 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | GGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | HNF4G hepatocyte nuclear factor 4, gamma [ Homo sapiens ] |
Official Symbol | HNF4G |
Synonyms | HNF4G; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; NR2A2; HNF-4-gamma; nuclear receptor subfamily 2 group A member 2; NR2A3; |
mRNA Refseq | NM_004133 |
Protein Refseq | NP_004124 |
MIM | 605966 |
UniProt ID | Q14541 |
Gene ID | 3174 |
◆ Recombinant Proteins | ||
HNF4G-2561H | Recombinant Human HNF4G protein, His-tagged | +Inquiry |
HNF4G-301151H | Recombinant Human HNF4G protein, GST-tagged | +Inquiry |
HNF4G-4458Z | Recombinant Zebrafish HNF4G | +Inquiry |
HNF4G-29372TH | Recombinant Human HNF4G | +Inquiry |
HNF4G-4897H | Recombinant Human HNF4G Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNF4G-333HCL | Recombinant Human HNF4G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNF4G Products
Required fields are marked with *
My Review for All HNF4G Products
Required fields are marked with *