Recombinant Human HNF4G Protein, GST-tagged

• Cat.No.: HNF4G-4897H
• Product Overview: Human HNF4G partial ORF ( NP_004124.3, 310 a.a. - 407 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HNF4G (Hepatocyte Nuclear Factor 4 Gamma) is a Protein Coding gene. Diseases associated with HNF4G include Maturity-Onset Diabetes Of The Young. Among its related pathways are Regulation of beta-cell development and Gene Expression. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and steroid hormone receptor activity. An important paralog of this gene is HNF4A.
• Molecular Mass: 36.52 kDa
• AA Sequence: KLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HNF4G hepatocyte nuclear factor 4, gamma [ Homo sapiens ]
• Official Symbol: HNF4G
• Synonyms: HNF4G; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; NR2A2; HNF-4-gamma; nuclear receptor subfamily 2 group A member 2; NR2A3
• Gene ID: 3174
• mRNA Refseq: NM_004133
• Protein Refseq: NP_004124
• MIM: 605966
• UniProt ID: Q14541