"HOXB5" Related Products

Expand

Recombinant Human HOXB5

Cat.No.: HOXB5-28512TH
Product Overview: Recombinant fragment of Human HOXB5 with an N terminal proprietary tag; Predicted MWt 36.41 kDa.
Description: This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Spinal cord.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAF
Sequence Similarities: Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: HOXB5 homeobox B5 [ Homo sapiens ]
Official Symbol: HOXB5
Synonyms: HOXB5; homeobox B5; homeo box B5 , HOX2, HOX2A; homeobox protein Hox-B5;
Gene ID: 3215
mRNA Refseq: NM_002147
Protein Refseq: NP_002138
MIM: 142960
Uniprot ID: P09067
Chromosome Location: 17q21.32
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.