Recombinant Human HOXB5

Cat.No. : HOXB5-28512TH
Product Overview : Recombinant fragment of Human HOXB5 with an N terminal proprietary tag; Predicted MWt 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Spinal cord.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAF
Sequence Similarities : Belongs to the Antp homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name HOXB5 homeobox B5 [ Homo sapiens ]
Official Symbol HOXB5
Synonyms HOXB5; homeobox B5; homeo box B5 , HOX2, HOX2A; homeobox protein Hox-B5;
Gene ID 3215
mRNA Refseq NM_002147
Protein Refseq NP_002138
MIM 142960
Uniprot ID P09067
Chromosome Location 17q21.32
Function sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXB5 Products

Required fields are marked with *

My Review for All HOXB5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon