Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human HSP90B1, His-tagged

Cat.No. : HSP90B1-27413TH
Product Overview : Recombinant fragment, corresponding to amino acids 341-803 of Human GRP94 with N terminal His tag; 463 amino acids, 57kDa.
  • Specification
  • Gene Information
  • Related Products
Description : HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. HSP90B1 is an endoplasmic reticulum HSP90 protein. Other HSP90 proteins are found in cytosol (see HSP90AA1; MIM 140571) and mitochondria (TRAP1; MIM 606219) (Chen et al.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : PIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGE VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFI TDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLK VIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGV IEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEK QDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDE YCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVE KEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVAS QYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPR HPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYL LPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEET AEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL
Sequence Similarities : Belongs to the heat shock protein 90 family.
Gene Name : HSP90B1 heat shock protein 90kDa beta (Grp94), member 1 [ Homo sapiens ]
Official Symbol : HSP90B1
Synonyms : HSP90B1; heat shock protein 90kDa beta (Grp94), member 1; TRA1, tumor rejection antigen (gp96) 1; endoplasmin; GP96; GRP94;
Gene ID : 7184
mRNA Refseq : NM_003299
Protein Refseq : NP_003290
MIM : 191175
Uniprot ID : P14625
Chromosome Location : 12q24.2-q24.3
Pathway : Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; IL6-mediated signaling events, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem;
Function : ATP binding; RNA binding; calcium ion binding; low-density lipoprotein particle receptor binding; nucleotide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
How does HSP90B1 interact with other cellular components in the endoplasmic reticulum? 10/04/2022

HSP90B1 interacts with various proteins and participates in complex cellular processes, including protein folding, quality control, and antigen presentation.

Are there any ongoing clinical trials targeting HSP90B1 for therapeutic purposes? 07/03/2020

It's possible. You may want to check the latest clinical trial databases for the most up-to-date information.

Does the expression of HSP90B1 vary in different tissues of the human body? 10/21/2018

Yes, the expression of HSP90B1 can vary among tissues, reflecting its diverse functions in different cellular environments.

Can HSP90B1 be used as a diagnostic marker for certain diseases? 08/25/2017

Research suggests that HSP90B1 levels may be altered in some diseases, making it a potential diagnostic marker, but more studies are needed for validation.

Can genetic mutations in HSP90B1 lead to diseases? 06/14/2016

Mutations in HSP90B1 have been associated with certain diseases, highlighting the importance of its proper function for cellular health.

Customer Reviews (3)

Write a review
Reviews
05/03/2022

    Their in-depth understanding of the protein's characteristics, applications, and potential limitations allows for valuable insights and recommendations, ensuring the success of my experiments.

    12/22/2018

      Whether it's troubleshooting, protocol optimization, or general inquiries, their knowledgeable and responsive team is readily available to assist and solve any problems that may arise during the experimental process.

      12/15/2018

        Its purity, integrity, and consistency ensure reliable and reproducible results, which are essential for meaningful scientific discoveries.

        Ask a Question for All HSP90B1 Products

        Required fields are marked with *

        My Review for All HSP90B1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends