"HSP90B1" Related Products

Expand
Expand
Expand

Recombinant Human HSP90B1, His-tagged

Cat.No.: HSP90B1-27413TH
Product Overview: Recombinant fragment, corresponding to amino acids 341-803 of Human GRP94 with N terminal His tag; 463 amino acids, 57kDa.
Description: HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. HSP90B1 is an endoplasmic reticulum HSP90 protein. Other HSP90 proteins are found in cytosol (see HSP90AA1; MIM 140571) and mitochondria (TRAP1; MIM 606219) (Chen et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: PIWQRPSKEVEEDEYKAFYKSFSKESDDPMAYIHFTAEGE VTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFI TDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLK VIRKKLVRKTLDMIKKIADDKYNDTFWKEFGTNIKLGV IEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEK QDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDE YCIQALPEFDGKRFQNVAKEGVKFDESEKTKESREAVE KEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVAS QYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPR HPLIRDMLRRIKEDEDDKTVLDLAVVLFETATLRSGYL LPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEET AEDTTEDTEQDEDEEMDVGTDEEEETAKESTAEKDEL
Sequence Similarities: Belongs to the heat shock protein 90 family.
Gene Name: HSP90B1 heat shock protein 90kDa beta (Grp94), member 1 [ Homo sapiens ]
Official Symbol: HSP90B1
Synonyms: HSP90B1; heat shock protein 90kDa beta (Grp94), member 1; TRA1, tumor rejection antigen (gp96) 1; endoplasmin; GP96; GRP94;
Gene ID: 7184
mRNA Refseq: NM_003299
Protein Refseq: NP_003290
MIM: 191175
Uniprot ID: P14625
Chromosome Location: 12q24.2-q24.3
Pathway: Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; IL6-mediated signaling events, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem;
Function: ATP binding; RNA binding; calcium ion binding; low-density lipoprotein particle receptor binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.