"HTR2B" Related Products

Expand
Expand

Recombinant Human HTR2B

Cat.No.: HTR2B-26027TH
Product Overview: Recombinant fragment corresponding to amino acids 1-56 of Human 5HT2B Receptor with N terminal proprietary tag; predicted MWt 31.79 kDa inclusive of tag.
Description: This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved.
Protein length: 56 amino acids
Molecular Weight: 31.790kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Detected in most peripheral organs. Only low expression levels were found in the brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: HTR2B 5-hydroxytryptamine (serotonin) receptor 2B [ Homo sapiens ]
Official Symbol: HTR2B
Synonyms: HTR2B; 5-hydroxytryptamine (serotonin) receptor 2B; 5-hydroxytryptamine receptor 2B; 5 HT(2B); 5 HT2B;
Gene ID: 3357
mRNA Refseq: NM_000867
Protein Refseq: NP_000858
MIM: 601122
Uniprot ID: P41595
Chromosome Location: 2q36.3-q37.1
Pathway: Amine ligand-binding receptors, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem;
Function: G-protein alpha-subunit binding; G-protein coupled receptor activity; Ras GTPase activator activity; calcium channel activity; drug binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.