Recombinant Full Length Tetraodon Fluviatilis 5-Hydroxytryptamine Receptor 2B(Htr2B) Protein, His-Tagged
Cat.No. : | RFL1319TF |
Product Overview : | Recombinant Full Length Tetraodon fluviatilis 5-hydroxytryptamine receptor 2B(htr2b) Protein (Q8UUG8) (1-471aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Tetraodon fluviatilis (Green pufferfish) (Chelonodon fluviatilis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-471) |
Form : | Lyophilized powder |
AA Sequence : | MFQAAVGPLQTNISLPEETPGLELNWAALLIVMVIIPTIGGNILVILAVWLEKKLQNATN FFLMSLAVADLLVGLLVMPIALITILYDSDWPLPEPLCPIWLFLDVLFSTASIMHLCAIS LDRYIAIKKPIQHSQYKSRAKVMLKIALVWLISICIAIPIPIKGLRNYPHPNNITFTSNH TCVLKTDTFQEFIIFGSLVAFFIPLTIMMIIYFLTVRVLRKKVYLLRSKVTQRFSYPIIS TVFQREQAANPPQPEQPDSTGNSLARIQEKTDTDGMSSPTGDEKSFRRLSTMGKKSMQTL TNEQRASKVLGIVFLLFVVMWCPFFITNITSALCGPCDANIIGRLMEIFSWVGYVSSGIN PLVYTLFNKTFRQAFTRYITCNYRNFASKEQGRSFRASTVDRMLTHISPRSSVAENAKLF TKQEIKNETTDYRSPLGCLQPSAQTSTGVVLDKILLTHTENCKQEERVSCV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | htr2b |
Synonyms | htr2b; 5-hydroxytryptamine receptor 2B; 5-HT-2B; 5-HT2B; Serotonin receptor 2B |
UniProt ID | Q8UUG8 |
◆ Recombinant Proteins | ||
RFL34021CF | Recombinant Full Length Guinea Pig 5-Hydroxytryptamine Receptor 2B(Htr2B) Protein, His-Tagged | +Inquiry |
HTR2B-5684HF | Recombinant Full Length Human HTR2B Protein, GST-tagged | +Inquiry |
HTR2B-3901Z | Recombinant Zebrafish HTR2B | +Inquiry |
HTR2B-1091HFL | Recombinant Human HTR2B protein, His&Flag-tagged | +Inquiry |
RFL1319TF | Recombinant Full Length Tetraodon Fluviatilis 5-Hydroxytryptamine Receptor 2B(Htr2B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR2B-5335HCL | Recombinant Human HTR2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All htr2b Products
Required fields are marked with *
My Review for All htr2b Products
Required fields are marked with *
0
Inquiry Basket