"HYOU1" Related Products

Expand
Expand

Recombinant Human HYOU1, His-tagged

Cat.No.: HYOU1-30518TH
Product Overview: Recombinant fragment, corresponding to amino acids 424-999 of Human ORP150 with N terminal His tag; Predicted MWt 65 kDa.
Description: The protein encoded by this gene belongs to the heat shock protein 70 family. This gene uses alternative transcription start sites. A cis-acting segment found in the 5 UTR is involved in stress-dependent induction, resulting in the accumulation of this protein in the endoplasmic reticulum (ER) under hypoxic conditions. The protein encoded by this gene is thought to play an important role in protein folding and secretion in the ER. Since suppression of the protein is associated with accelerated apoptosis, it is also suggested to have an important cytoprotective role in hypoxia-induced cellular perturbation. This protein has been shown to be up-regulated in tumors, especially in breast tumors, and thus it is associated with tumor invasiveness. This gene also has an alternative translation initiation site, resulting in a protein that lacks the N-terminal signal peptide. This signal peptide-lacking protein, which is only 3 amino acids shorter than the mature protein in the ER, is thought to have a housekeeping function in the cytosol. In rat, this protein localizes to both the ER by a carboxy-terminal peptide sequence and to mitochondria by an amino-terminal targeting signal.
Conjugation: HIS
Source: E. coli
Tissue specificity: Highly expressed in tissues that contain well-developed endoplasmic reticulum and synthesize large amounts of secretory proteins. Highly expressed in liver and pancreas and lower expression in brain and kidney. Also expressed in macrophages within aortic
Form: Lyophilised:Reconstitute with 129 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLK HNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDLG FLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGI KAHFNLDESGVLSLDRVESVFETLVEDSAEEESTLTKL GNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPKGDATPEGEKATEK ENGDKSEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKR RMVEEIGVELVVLDLPDLPEDKLAQSVQKLQDLTLRDL EKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQRE EISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGARLIPEMDQ IFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPV LLSKDIEAKMMALDREVQYLLNKAKFTKPRPRPKDKNG TRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVE TGSEPGDTEPLELGGPGAEPEQKEQSTGQKRPLKNDEL
Sequence Similarities: Belongs to the heat shock protein 70 family.
Gene Name: HYOU1 hypoxia up-regulated 1 [ Homo sapiens ]
Official Symbol: HYOU1
Synonyms: HYOU1; hypoxia up-regulated 1; hypoxia up-regulated protein 1; glucose regulated protein 170; Grp170; HSP12A; ORP150;
Gene ID: 10525
mRNA Refseq: NM_001130991
Protein Refseq: NP_001124463
MIM: 601746
Uniprot ID: Q9Y4L1
Chromosome Location: 11q23.1-q23.3
Pathway: Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem;
Function: ATP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.