"ID3" Related Products

Expand

Recombinant Human ID3

Cat.No.: ID3-28591TH
Product Overview: Recombinant fragment of Human ID3 with N terminal proprietary tag, 34.76kDa.
Description: The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts.
Protein length: 83 amino acids
Molecular Weight: 34.760kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name: ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein [ Homo sapiens ]
Official Symbol: ID3
Synonyms: ID3; inhibitor of DNA binding 3, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-3; bHLHb25; HEIR 1;
Gene ID: 3399
mRNA Refseq: NM_002167
Protein Refseq: NP_002158
MIM: 600277
Uniprot ID: Q02535
Chromosome Location: 1p36.13-p36.12
Pathway: Adipogenesis, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function: protein domain specific binding; transcription corepressor activity; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.