"IL12RB2" Related Products

Expand
Expand

Recombinant Human IL12RB2

Cat.No.: IL12RB2-29640TH
Product Overview: Recombinant fragment of Human IL12RB2 with an N-terminal proprietary tag; Predicted MW 37.73 kDa
Description: The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohns disease and leprosy, which is thought to contribute to the inflammatory response and host defense.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa
Source: Wheat germ
Tissue specificity: Isoform 2 is expressed at similar levels in both naive and activated T-cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS
Sequence Similarities: Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.
Gene Name: IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ]
Official Symbol: IL12RB2
Synonyms: IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2;
Gene ID: 3595
mRNA Refseq: NM_001559
Protein Refseq: NP_001550
MIM: 601642
Uniprot ID: Q99665
Chromosome Location: 1p31.3-p31.2
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem;
Function: cytokine receptor activity; protein kinase binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.