Recombinant Human IL12RB2
Cat.No. : | IL12RB2-29640TH |
Product Overview : | Recombinant fragment of Human IL12RB2 with an N-terminal proprietary tag; Predicted MW 37.73 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohns disease and leprosy, which is thought to contribute to the inflammatory response and host defense. |
Molecular Weight : | 37.730kDa |
Tissue specificity : | Isoform 2 is expressed at similar levels in both naive and activated T-cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS |
Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains. |
Gene Name | IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ] |
Official Symbol | IL12RB2 |
Synonyms | IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2; |
Gene ID | 3595 |
mRNA Refseq | NM_001559 |
Protein Refseq | NP_001550 |
MIM | 601642 |
Uniprot ID | Q99665 |
Chromosome Location | 1p31.3-p31.2 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; |
Function | cytokine receptor activity; protein kinase binding; receptor activity; |
◆ Recombinant Proteins | ||
IL12RB2-1464H | Recombinant Human IL12RB2 protein, His-tagged | +Inquiry |
IL12RB2-1465H | Recombinant Human IL12RB2 protein, His & GST-tagged | +Inquiry |
Il12rb2-5695M | Recombinant Mouse Il12rb2 Protein (Met1-Asn637), C-Fc tagged | +Inquiry |
IL12RB2-73H | Recombinant Human IL12RB2 protein, Fc-tagged | +Inquiry |
IL12RB2-3884H | Recombinant Human IL12RB2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12RB2-2142MCL | Recombinant Mouse IL12RB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12RB2 Products
Required fields are marked with *
My Review for All IL12RB2 Products
Required fields are marked with *