Recombinant Human IL12RB2
| Cat.No. : | IL12RB2-29640TH |
| Product Overview : | Recombinant fragment of Human IL12RB2 with an N-terminal proprietary tag; Predicted MW 37.73 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohns disease and leprosy, which is thought to contribute to the inflammatory response and host defense. |
| Molecular Weight : | 37.730kDa |
| Tissue specificity : | Isoform 2 is expressed at similar levels in both naive and activated T-cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS |
| Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains. |
| Gene Name | IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ] |
| Official Symbol | IL12RB2 |
| Synonyms | IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2; |
| Gene ID | 3595 |
| mRNA Refseq | NM_001559 |
| Protein Refseq | NP_001550 |
| MIM | 601642 |
| Uniprot ID | Q99665 |
| Chromosome Location | 1p31.3-p31.2 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; |
| Function | cytokine receptor activity; protein kinase binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| IL12RB2-29640TH | Recombinant Human IL12RB2 | +Inquiry |
| Il12rb2-5695M | Recombinant Mouse Il12rb2 Protein (Met1-Asn637), C-Fc tagged | +Inquiry |
| IL12RB2-214H | Recombinant Human IL12RB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL12RB2-3230H | Recombinant Human IL12RB2 Protein, His-tagged | +Inquiry |
| IL12RB2-1465H | Recombinant Human IL12RB2 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL12RB2-2142MCL | Recombinant Mouse IL12RB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12RB2 Products
Required fields are marked with *
My Review for All IL12RB2 Products
Required fields are marked with *
