Recombinant Human IL12RB2

Cat.No. : IL12RB2-29640TH
Product Overview : Recombinant fragment of Human IL12RB2 with an N-terminal proprietary tag; Predicted MW 37.73 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohns disease and leprosy, which is thought to contribute to the inflammatory response and host defense.
Molecular Weight : 37.730kDa
Tissue specificity : Isoform 2 is expressed at similar levels in both naive and activated T-cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS
Sequence Similarities : Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.
Gene Name IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ]
Official Symbol IL12RB2
Synonyms IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2;
Gene ID 3595
mRNA Refseq NM_001559
Protein Refseq NP_001550
MIM 601642
Uniprot ID Q99665
Chromosome Location 1p31.3-p31.2
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem;
Function cytokine receptor activity; protein kinase binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL12RB2 Products

Required fields are marked with *

My Review for All IL12RB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon