Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human IL12RB2

Cat.No. : IL12RB2-29640TH
Product Overview : Recombinant fragment of Human IL12RB2 with an N-terminal proprietary tag; Predicted MW 37.73 kDa
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohns disease and leprosy, which is thought to contribute to the inflammatory response and host defense.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa
Source : Wheat germ
Tissue specificity : Isoform 2 is expressed at similar levels in both naive and activated T-cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS
Sequence Similarities : Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.
Gene Name : IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ]
Official Symbol : IL12RB2
Synonyms : IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2;
Gene ID : 3595
mRNA Refseq : NM_001559
Protein Refseq : NP_001550
MIM : 601642
Uniprot ID : Q99665
Chromosome Location : 1p31.3-p31.2
Pathway : Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem;
Function : cytokine receptor activity; protein kinase binding; receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends