"IMPA1" Related Products

Expand

Recombinant Human IMPA1, His-tagged

Cat.No.: IMPA1-29490TH
Product Overview: Recombinant full length Human IMPA1 with N terminal His tag; 297 amino acids with tag, MWt 32.3 kDa.
Description: This gene encodes an enyzme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol. This enzyme can also use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2-AMP as substrates. This enzyme shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. Inhibition of inositol monophosphate hydroylosis and subsequent depletion of inositol for phosphatidylinositol synthesis may explain the anti-manic and anti-depressive effects of lithium administered to treat bipolar disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. A pseudogene of this gene is also present on chromosome 8q21.13.
Protein length: 277 amino acids
Conjugation: HIS
Molecular Weight: 32.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Gene Name: IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 [ Homo sapiens ]
Official Symbol: IMPA1
Synonyms: IMPA1; inositol(myo)-1(or 4)-monophosphatase 1; IMPA; inositol monophosphatase 1;
Gene ID: 3612
mRNA Refseq: NM_001144878
Protein Refseq: NP_001138350
MIM: 602064
Uniprot ID: P29218
Chromosome Location: 8q21.1-q21.3
Pathway: D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 =>
Function: hydrolase activity; inositol monophosphate phosphatase activity; inositol monophosphate phosphatase activity; metal ion binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.