Recombinant Human IMPA1, His-tagged

• Cat.No.: IMPA1-29490TH
• Product Overview: Recombinant full length Human IMPA1 with N terminal His tag; 297 amino acids with tag, MWt 32.3 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 277 amino acids
• Description: This gene encodes an enyzme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol. This enzyme can also use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2-AMP as substrates. This enzyme shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. Inhibition of inositol monophosphate hydroylosis and subsequent depletion of inositol for phosphatidylinositol synthesis may explain the anti-manic and anti-depressive effects of lithium administered to treat bipolar disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. A pseudogene of this gene is also present on chromosome 8q21.13.
• Conjugation: HIS
• Molecular Weight: 32.300kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED

Gene Information

• Gene Name: IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 [ Homo sapiens ]
• Official Symbol: IMPA1
• Synonyms: IMPA1; inositol(myo)-1(or 4)-monophosphatase 1; IMPA; inositol monophosphatase 1
• Gene ID: 3612
• mRNA Refseq: NM_001144878
• Protein Refseq: NP_001138350
• MIM: 602064
• Uniprot ID: P29218
• Chromosome Location: 8q21.1-q21.3
• Pathway: D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 =>
• Function: hydrolase activity; inositol monophosphate phosphatase activity; inositol monophosphate phosphatase activity; metal ion binding; protein homodimerization activity