"ING5" Related Products

Expand
Expand

Recombinant Human ING5, His-tagged

Cat.No.: ING5-27620TH
Product Overview: Recombinant fragment, corresponding to amino acids 2-240 of Human ING5 with N terminal His tag; 239 amino acids, kDa.
Description: The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in TP53-dependent regulatory pathway.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 71 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAE IDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYS DDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKK HKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVS YGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
Gene Name: ING5 inhibitor of growth family, member 5 [ Homo sapiens ]
Official Symbol: ING5
Synonyms: ING5; inhibitor of growth family, member 5; inhibitor of growth protein 5; FLJ23842; p28ING5;
Gene ID: 84289
mRNA Refseq: NM_032329
Protein Refseq: NP_115705
MIM: 608525
Uniprot ID: Q8WYH8
Chromosome Location: 2q37.3
Function: metal ion binding; methylated histone residue binding; protein binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.