Recombinant Human ITGAE
Cat.No. : | ITGAE-29495TH |
Product Overview : | Recombinant fragment of Human Integrin alpha E with N terminal proprietary tag, predicted mwt: 38.28 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. |
Protein length : | 115 amino acids |
Molecular Weight : | 38.280kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed on a subclass of T-lymphocytes known as intra-epithelial lymphocytes which are located between mucosal epithelial cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVT VVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQ AQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV |
Sequence Similarities : | Belongs to the integrin alpha chain family.Contains 7 FG-GAP repeats.Contains 1 VWFA domain. |
Gene Name : | ITGAE integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide) [ Homo sapiens ] |
Official Symbol : | ITGAE |
Synonyms : | ITGAE; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin alpha-E; CD103; HUMINAE; |
Gene ID : | 3682 |
mRNA Refseq : | NM_002208 |
Protein Refseq : | NP_002199 |
MIM : | 604682 |
Uniprot ID : | P38570 |
Chromosome Location : | 17p13 |
Pathway : | E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Integrin-mediated cell adhesion, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; |
Function : | receptor activity; |
Products Types
◆ Recombinant Protein | ||
ITGAE-2513H | Recombinant Human ITGAE Protein, MYC/DDK-tagged | +Inquiry |
ITGAE-4640M | Recombinant Mouse ITGAE Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGAE-4990H | Recombinant Human ITGAE Protein, GST-tagged | +Inquiry |
Itgae-3600M | Recombinant Mouse Itgae Protein, Myc/DDK-tagged | +Inquiry |
ITGAE-4321H | Recombinant Human ITGAE Protein (Met1-Ser1124), C-His tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All ITGAE Products
Required fields are marked with *
My Review for All ITGAE Products
Required fields are marked with *
0
Inquiry Basket