Recombinant Human ITGAE ITGAE-29495TH

Recombinant Human ITGAE

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ITGAE

Recombinant Human ITGAE

ITGAE Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ITGAE-29495TH
Product Overview : Recombinant fragment of Human Integrin alpha E with N terminal proprietary tag, predicted mwt: 38.28 kDa.
Description : Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation.
Protein length : 115 amino acids
Molecular Weight : 38.280kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed on a subclass of T-lymphocytes known as intra-epithelial lymphocytes which are located between mucosal epithelial cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVT VVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQ AQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
Sequence Similarities : Belongs to the integrin alpha chain family.Contains 7 FG-GAP repeats.Contains 1 VWFA domain.
Gene Name : ITGAE integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide) [ Homo sapiens ]
Official Symbol : ITGAE
Synonyms : ITGAE; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin alpha-E; CD103; HUMINAE;
Gene ID : 3682
mRNA Refseq : NM_002208
Protein Refseq : NP_002199
MIM : 604682
Uniprot ID : P38570
Chromosome Location : 17p13
Pathway : E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Integrin-mediated cell adhesion, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem;
Function : receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy