"ITGAE" Related Products

Expand
Expand

Recombinant Human ITGAE

Cat.No.: ITGAE-29495TH
Product Overview: Recombinant fragment of Human Integrin alpha E with N terminal proprietary tag, predicted mwt: 38.28 kDa.
Description: Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation.
Protein length: 115 amino acids
Molecular Weight: 38.280kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed on a subclass of T-lymphocytes known as intra-epithelial lymphocytes which are located between mucosal epithelial cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVT VVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQ AQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
Sequence Similarities: Belongs to the integrin alpha chain family.Contains 7 FG-GAP repeats.Contains 1 VWFA domain.
Gene Name: ITGAE integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide) [ Homo sapiens ]
Official Symbol: ITGAE
Synonyms: ITGAE; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin alpha-E; CD103; HUMINAE;
Gene ID: 3682
mRNA Refseq: NM_002208
Protein Refseq: NP_002199
MIM: 604682
Uniprot ID: P38570
Chromosome Location: 17p13
Pathway: E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Integrin-mediated cell adhesion, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem;
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.