Recombinant Human ITGAE
Cat.No. : | ITGAE-29495TH |
Product Overview : | Recombinant fragment of Human Integrin alpha E with N terminal proprietary tag, predicted mwt: 38.28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 115 amino acids |
Description : | Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation. |
Molecular Weight : | 38.280kDa inclusive of tags |
Tissue specificity : | Expressed on a subclass of T-lymphocytes known as intra-epithelial lymphocytes which are located between mucosal epithelial cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVT VVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQ AQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV |
Sequence Similarities : | Belongs to the integrin alpha chain family.Contains 7 FG-GAP repeats.Contains 1 VWFA domain. |
Gene Name | ITGAE integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide) [ Homo sapiens ] |
Official Symbol | ITGAE |
Synonyms | ITGAE; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin alpha-E; CD103; HUMINAE; |
Gene ID | 3682 |
mRNA Refseq | NM_002208 |
Protein Refseq | NP_002199 |
MIM | 604682 |
Uniprot ID | P38570 |
Chromosome Location | 17p13 |
Pathway | E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Integrin-mediated cell adhesion, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
ITGAE-8357M | Recombinant Mouse ITGAE Protein | +Inquiry |
Itgae-3600M | Recombinant Mouse Itgae Protein, Myc/DDK-tagged | +Inquiry |
ITGAE-29495TH | Recombinant Human ITGAE | +Inquiry |
Itgae-6960M | Recombinant Mouse Itgae protein, His & T7-tagged | +Inquiry |
ITGAE-4640M | Recombinant Mouse ITGAE Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGAE Products
Required fields are marked with *
My Review for All ITGAE Products
Required fields are marked with *