Recombinant Human ITGAE

Cat.No. : ITGAE-29495TH
Product Overview : Recombinant fragment of Human Integrin alpha E with N terminal proprietary tag, predicted mwt: 38.28 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 115 amino acids
Description : Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation.
Molecular Weight : 38.280kDa inclusive of tags
Tissue specificity : Expressed on a subclass of T-lymphocytes known as intra-epithelial lymphocytes which are located between mucosal epithelial cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVT VVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQ AQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
Sequence Similarities : Belongs to the integrin alpha chain family.Contains 7 FG-GAP repeats.Contains 1 VWFA domain.
Gene Name ITGAE integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide) [ Homo sapiens ]
Official Symbol ITGAE
Synonyms ITGAE; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); integrin alpha-E; CD103; HUMINAE;
Gene ID 3682
mRNA Refseq NM_002208
Protein Refseq NP_002199
MIM 604682
Uniprot ID P38570
Chromosome Location 17p13
Pathway E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Integrin-mediated cell adhesion, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem;
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGAE Products

Required fields are marked with *

My Review for All ITGAE Products

Required fields are marked with *

0
cart-icon
0
compare icon