"ITGB6" Related Products

Expand

Recombinant Human ITGB6

Cat.No.: ITGB6-29868TH
Product Overview: Recombinant full length Human ITGB6 with N terminal proprietary tag. Predicted MW 112.75 kDa.
Description: Integrin beta-6 is a protein that in humans is encoded by the ITGB6 gene.
Protein length: 788 amino acids
Molecular Weight: 112.750kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQ CAWCAQENFTHPSGVGERCDTPANLLAKGCQLNFIENPVS QVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLS KEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSI PYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDS KLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLV QNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLF QHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGL GDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCG QCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDC GECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG KCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQ AREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLI TFLITTDNEGKTIIHSINEKDCPKPPNIPMIMLGVSLAIL LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNP LYRGSTSTFKNVTYKHREKQKVDLSTDC
Sequence Similarities: Belongs to the integrin beta chain family.Contains 1 VWFA domain.
Gene Name: ITGB6 integrin, beta 6 [ Homo sapiens ]
Official Symbol: ITGB6
Synonyms: ITGB6; integrin, beta 6; integrin beta-6;
Gene ID: 3694
mRNA Refseq: NM_000888
Protein Refseq: NP_000879
MIM: 147558
Uniprot ID: P18564
Chromosome Location: 2q24.2
Pathway: Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; ECM-receptor interaction, organism-specific biosystem;
Function: binding; integrin binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.