"KIDINS220" Related Products

Recombinant Human KIDINS220, His-tagged

Cat.No.: KIDINS220-26700TH
Product Overview: Recombinant fragment, corresponding to amino acids 1604-1771 of Human Kidins220 with an N terminal His tag.MW 38 kDa ;
Conjugation: HIS
Source: E. coli
Tissue specificity: Abundant in developing and adult neural tissues as well as neuroendocrine cells and dendritic cells. Overexpressed in melanoma and melanoma cell lines.
Form: Lyophilised:Reconstitute with 78 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ADDSQLEKANLIELEDDSHSGKRGIPHSLSGLQDPIIARM SICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTPS TVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSP NPTTIQNENLKSMTHKRSQRSSYTRLSKDPPELHAAASSE STGFGEERESIL
Sequence Similarities: Contains 12 ANK repeats.Contains 1 KAP NTPase domain.
Gene Name: KIDINS220 kinase D-interacting substrate, 220kDa [ Homo sapiens ]
Official Symbol: KIDINS220
Synonyms: KIDINS220; kinase D-interacting substrate, 220kDa; kinase D-interacting substrate of 220 kDa; ankyrin repeat rich membrane spanning protein; ARMS;
Gene ID: 57498
mRNA Refseq: NM_020738
Protein Refseq: NP_065789
Uniprot ID: Q9ULH0
Chromosome Location: 2p24
Pathway: ARMS-mediated activation, organism-specific biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem; Prolonged ERK activation events, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.