Recombinant Human KIDINS220, His-tagged
Cat.No. : | KIDINS220-26700TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1604-1771 of Human Kidins220 with an N terminal His tag.MW 38 kDa ; |
- Specification
- Gene Information
- Related Products
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Abundant in developing and adult neural tissues as well as neuroendocrine cells and dendritic cells. Overexpressed in melanoma and melanoma cell lines. |
Form : | Lyophilised:Reconstitute with 78 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ADDSQLEKANLIELEDDSHSGKRGIPHSLSGLQDPIIARM SICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTPS TVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSP NPTTIQNENLKSMTHKRSQRSSYTRLSKDPPELHAAASSE STGFGEERESIL |
Sequence Similarities : | Contains 12 ANK repeats.Contains 1 KAP NTPase domain. |
Gene Name : | KIDINS220 kinase D-interacting substrate, 220kDa [ Homo sapiens ] |
Official Symbol : | KIDINS220 |
Synonyms : | KIDINS220; kinase D-interacting substrate, 220kDa; kinase D-interacting substrate of 220 kDa; ankyrin repeat rich membrane spanning protein; ARMS; |
Gene ID : | 57498 |
mRNA Refseq : | NM_020738 |
Protein Refseq : | NP_065789 |
Uniprot ID : | Q9ULH0 |
Chromosome Location : | 2p24 |
Pathway : | ARMS-mediated activation, organism-specific biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem; Prolonged ERK activation events, organism-specific biosystem; |
Products Types
◆ Recombinant Protein | ||
KIDINS220-2905R | Recombinant Rat KIDINS220 Protein, His (Fc)-Avi-tagged | +Inquiry |
KIDINS220-32H | Recombinant Human KIDINS220 protein, GST-tagged | +Inquiry |
KIDINS220-3249R | Recombinant Rat KIDINS220 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All KIDINS220 Products
Required fields are marked with *
My Review for All KIDINS220 Products
Required fields are marked with *
0
Inquiry Basket