Recombinant Human LAMP2
Cat.No. : | LAMP2-27946TH |
Product Overview : | Recombinant fragment corresponding to amino acids 30-127 of Human LAMP2 with a N terminal propriatery tag; predicted MWt 6.41 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Isoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle. Isoform LAMP-2B is highly expressed in skeletal muscle, less in brain, placenta, lung, kidney and pancreas, very low in liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP |
Sequence Similarities : | Belongs to the LAMP family. |
Gene Name | LAMP2 lysosomal-associated membrane protein 2 [ Homo sapiens ] |
Official Symbol | LAMP2 |
Synonyms | LAMP2; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; CD107b; |
Gene ID | 3920 |
mRNA Refseq | NM_001122606 |
Protein Refseq | NP_001116078 |
MIM | 309060 |
Uniprot ID | P13473 |
Chromosome Location | Xq24-q25 |
Pathway | Hemostasis, organism-specific biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; |
◆ Cell & Tissue Lysates | ||
LAMP2-1756MCL | Recombinant Mouse LAMP2 cell lysate | +Inquiry |
LAMP2-987CCL | Recombinant Cynomolgus LAMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMP2 Products
Required fields are marked with *
My Review for All LAMP2 Products
Required fields are marked with *