Recombinant Human LAMP2 protein(131-230 aa), C-His-tagged

Cat.No. : LAMP2-2647H
Product Overview : Recombinant Human LAMP2 protein(P13473)(131-230 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 131-230 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGND
Gene Name LAMP2 lysosomal-associated membrane protein 2 [ Homo sapiens ]
Official Symbol LAMP2
Synonyms LAMP2; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; CD107b; CD107 antigen-like family member B; lysosome-associated membrane protein 2; LAMPB; LAMP-2; LGP110;
Gene ID 3920
mRNA Refseq NM_001122606
Protein Refseq NP_001116078
MIM 309060
UniProt ID P13473

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAMP2 Products

Required fields are marked with *

My Review for All LAMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon