Recombinant Human LAMP2 protein(131-230 aa), C-His-tagged
| Cat.No. : | LAMP2-2647H |
| Product Overview : | Recombinant Human LAMP2 protein(P13473)(131-230 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 131-230 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGND |
| Gene Name | LAMP2 lysosomal-associated membrane protein 2 [ Homo sapiens ] |
| Official Symbol | LAMP2 |
| Synonyms | LAMP2; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; CD107b; CD107 antigen-like family member B; lysosome-associated membrane protein 2; LAMPB; LAMP-2; LGP110; |
| Gene ID | 3920 |
| mRNA Refseq | NM_001122606 |
| Protein Refseq | NP_001116078 |
| MIM | 309060 |
| UniProt ID | P13473 |
| ◆ Recombinant Proteins | ||
| Lamp2-6994R | Recombinant Rat Lamp2 protein, His-tagged | +Inquiry |
| LAMP2-1277H | Recombinant Human LAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LAMP2-233H | Recombinant Human LAMP2 Protein, His-tagged | +Inquiry |
| LAMP2-3391H | Recombinant Human LAMP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LAMP2-4418H | Recombinant Human LAMP2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAMP2-363HKCL | Human LAMP2 Knockdown Cell Lysate | +Inquiry |
| LAMP2-1756MCL | Recombinant Mouse LAMP2 cell lysate | +Inquiry |
| LAMP2-987CCL | Recombinant Cynomolgus LAMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMP2 Products
Required fields are marked with *
My Review for All LAMP2 Products
Required fields are marked with *



