"LRSAM1" Related Products

Expand
Expand

Recombinant Human LRSAM1, His-tagged

Cat.No.: LRSAM1-29433TH
Product Overview: Recombinant fragment, corresponding to amino acids 491-723 of Human LRSAM1 with N terminal His tag; Predicted MWt 28 kDa.
Description: LRSAM1 is a multifunctional RING finger protein that selectively regulates cell adhesion molecules, has ubiquitin ligase activity, and plays a role in receptor endocytosis and viral budding (Li et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 149 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELR EILTELEAKSETRQENYWLIQYQRLLNQKPLSLKLQEE GMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPG DLAKVGVSEAGLQHEILRRVQELLDAARIQPELKPPMG EVVTPTAPQEPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCCQPLRTCPLCRQDIAQRLRIYHS S
Gene Name: LRSAM1 leucine rich repeat and sterile alpha motif containing 1 [ Homo sapiens ]
Official Symbol: LRSAM1
Synonyms: LRSAM1; leucine rich repeat and sterile alpha motif containing 1; E3 ubiquitin-protein ligase LRSAM1; FLJ31641;
Gene ID: 90678
mRNA Refseq: NM_001190723
Protein Refseq: NP_001177652
MIM: 610933
Uniprot ID: Q6UWE0
Chromosome Location: 9q34.13
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: hormone activity; ligase activity; metal ion binding; protein binding; ubiquitin-protein ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.