"MAGEA12" Related Products

Recombinant Human MAGEA12

Cat.No.: MAGEA12-28504TH
Product Overview: Recombinant full length Human MAGEA12 with N terminal proprietary tag; Predicted MWt 60.61 kDa.
Description: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein length: 314 amino acids
Molecular Weight: 60.010kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETAS SSSTLVEVTLREVPAAESPSPPHSPQGASTLPTTINYTLW SQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFL LLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQL VFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTG LLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFA HPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVE TSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE
Sequence Similarities: Contains 1 MAGE domain.
Gene Name: MAGEA12 melanoma antigen family A, 12 [ Homo sapiens ]
Official Symbol: MAGEA12
Synonyms: MAGEA12; melanoma antigen family A, 12; MAGE12; melanoma-associated antigen 12; cancer/testis antigen family 1; member 12; CT1.12;
Gene ID: 4111
mRNA Refseq: NM_001166386
Protein Refseq: NP_001159858
MIM: 300177
Uniprot ID: P43365
Chromosome Location: Xq28
Function: molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.