Recombinant Human MAGEA12
Cat.No. : | MAGEA12-28504TH |
Product Overview : | Recombinant full length Human MAGEA12 with N terminal proprietary tag; Predicted MWt 60.61 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 314 amino acids |
Description : | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Molecular Weight : | 60.010kDa inclusive of tags |
Tissue specificity : | Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETAS SSSTLVEVTLREVPAAESPSPPHSPQGASTLPTTINYTLW SQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFL LLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQL VFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTG LLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFA HPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVE TSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE |
Sequence Similarities : | Contains 1 MAGE domain. |
Gene Name | MAGEA12 melanoma antigen family A, 12 [ Homo sapiens ] |
Official Symbol | MAGEA12 |
Synonyms | MAGEA12; melanoma antigen family A, 12; MAGE12; melanoma-associated antigen 12; cancer/testis antigen family 1; member 12; CT1.12; |
Gene ID | 4111 |
mRNA Refseq | NM_001166386 |
Protein Refseq | NP_001159858 |
MIM | 300177 |
Uniprot ID | P43365 |
Chromosome Location | Xq28 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
MAGEA12-28504TH | Recombinant Human MAGEA12 | +Inquiry |
MAGEA12-2410H | Recombinant Human MAGEA12 Protein, His-tagged | +Inquiry |
MAGEA12-294HF | Recombinant Full Length Human MAGEA12 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA12-4556HCL | Recombinant Human MAGEA12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAGEA12 Products
Required fields are marked with *
My Review for All MAGEA12 Products
Required fields are marked with *
0
Inquiry Basket