Description : |
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. |
Protein length : |
315 amino acids |
Molecular Weight : |
60.760kDa inclusive of tags |
Source : |
Wheat germ |
Tissue specificity : |
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta. |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEET TSSSDSKEEEVSAAGSSSPPQSPQGGASSSISVYYTLWSQ FDEGSSSQEEEEPSSSVDPAQLEFMFQEALELKVAELVHF LLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEFMQ VIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKA ALLIIVLGVILTKDNCAPEEVIWEALSVMGVYVGKEHMFY GEPRKLLTQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHA ETSYEKVINYLVMLNAREPICYPSLYEEVLGEEQEGV |
Sequence Similarities : |
Contains 1 MAGE domain. |