Recombinant Human MAGEA9
Cat.No. : | MAGEA9-30168TH |
Product Overview : | Recombinant full length Human MAGEA9 with a N terminal proprietary tag; Predicted MWt 60.76 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 315 amino acids |
Description : | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. |
Molecular Weight : | 60.760kDa inclusive of tags |
Tissue specificity : | Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEET TSSSDSKEEEVSAAGSSSPPQSPQGGASSSISVYYTLWSQ FDEGSSSQEEEEPSSSVDPAQLEFMFQEALELKVAELVHF LLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEFMQ VIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKA ALLIIVLGVILTKDNCAPEEVIWEALSVMGVYVGKEHMFY GEPRKLLTQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHA ETSYEKVINYLVMLNAREPICYPSLYEEVLGEEQEGV |
Sequence Similarities : | Contains 1 MAGE domain. |
Gene Name | MAGEA9 melanoma antigen family A, 9 [ Homo sapiens ] |
Official Symbol | MAGEA9 |
Synonyms | MAGEA9; melanoma antigen family A, 9; MAGE9; melanoma-associated antigen 9; cancer/testis antigen family 1; member 9; CT1.9; MAGE 9 antigen; melanoma associated antigen 9; MGC8421; |
Gene ID | 4108 |
mRNA Refseq | NM_005365 |
Protein Refseq | NP_005356 |
MIM | 300342 |
Uniprot ID | P43362 |
Chromosome Location | Xq28 |
◆ Recombinant Proteins | ||
MAGEA9-3362H | Recombinant Human MAGEA9 protein, His-tagged | +Inquiry |
MAGEA9-30168TH | Recombinant Human MAGEA9 | +Inquiry |
MAGEA9-297HF | Recombinant Full Length Human MAGEA9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA9-4549HCL | Recombinant Human MAGEA9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAGEA9 Products
Required fields are marked with *
My Review for All MAGEA9 Products
Required fields are marked with *
0
Inquiry Basket