Recombinant Full Length Human MAGEA9 Protein
Cat.No. : | MAGEA9-297HF |
Product Overview : | Recombinant full length Human MAGEA9 with a N terminal proprietary tag; Predicted MWt 60.76 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 60.760kDa inclusive of tags |
Protein Length : | 315 amino acids |
AA Sequence : | MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEET TSSSDSKEEEVSAAGSSSPPQSPQGGASSSISVYYTLWSQ FDEGSSSQEEEEPSSSVDPAQLEFMFQEALELKVAELVHF LLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEFMQ VIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKA ALLIIVLGVILTKDNCAPEEVIWEALSVMGVYVGKEHMFY GEPRKLLTQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHA ETSYEKVINYLVMLNAREPICYPSLYEEVLGEEQEGV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MAGEA9 melanoma antigen family A, 9 [ Homo sapiens ] |
Official Symbol : | MAGEA9 |
Synonyms : | MAGEA9; melanoma antigen family A, 9; MAGE9; melanoma-associated antigen 9; cancer/testis antigen family 1; member 9; CT1.9; MAGE 9 antigen; melanoma associated antigen 9; MGC8421 |
Gene ID : | 4108 |
mRNA Refseq : | NM_005365 |
Protein Refseq : | NP_005356 |
MIM : | 300342 |
UniProt ID : | P43362 |
Products Types
◆ Recombinant Protein | ||
MAGEA9-3362H | Recombinant Human MAGEA9 protein, His-tagged | +Inquiry |
MAGEA9-30168TH | Recombinant Human MAGEA9 | +Inquiry |
◆ Lysates | ||
MAGEA9-4549HCL | Recombinant Human MAGEA9 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket