Recombinant Full Length Human MAGEA9 Protein

Cat.No. : MAGEA9-297HF
Product Overview : Recombinant full length Human MAGEA9 with a N terminal proprietary tag; Predicted MWt 60.76 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 315 amino acids
Description : This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
Form : Liquid
Molecular Mass : 60.760kDa inclusive of tags
AA Sequence : MSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEET TSSSDSKEEEVSAAGSSSPPQSPQGGASSSISVYYTLWSQ FDEGSSSQEEEEPSSSVDPAQLEFMFQEALELKVAELVHF LLHKYRVKEPVTKAEMLESVIKNYKRYFPVIFGKASEFMQ VIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKA ALLIIVLGVILTKDNCAPEEVIWEALSVMGVYVGKEHMFY GEPRKLLTQDWVQENYLEYRQVPGSDPAHYEFLWGSKAHA ETSYEKVINYLVMLNAREPICYPSLYEEVLGEEQEGV
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name MAGEA9 melanoma antigen family A, 9 [ Homo sapiens ]
Official Symbol MAGEA9
Synonyms MAGEA9; melanoma antigen family A, 9; MAGE9; melanoma-associated antigen 9; cancer/testis antigen family 1; member 9; CT1.9; MAGE 9 antigen; melanoma associated antigen 9; MGC8421
Gene ID 4108
mRNA Refseq NM_005365
Protein Refseq NP_005356
MIM 300342
UniProt ID P43362

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAGEA9 Products

Required fields are marked with *

My Review for All MAGEA9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon