"MAP3K10" Related Products

Recombinant Human MAP3K10

Cat.No.: MAP3K10-30247TH
Product Overview: Recombinant fragment: FPRLPDPQAL FPARRRPPEF PGRPTTLTFA PRPRPAASRP RLDPWKLVSF GRTLTISPPS RPDTPESPGP PSVQPTLLDM DMEGQNQDST VPLCGAHGSH of Human MLK2 (amino acids 855-954) with N terminal proprietary tag, 36.63 kDa.
Description: The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase has been shown to activate MAPK8/JNK and MKK4/SEK1, and this kinase itself can be phoshorylated, and thus activated by JNK kinases. This kinase functions preferentially on the JNK signaling pathway, and is reported to be involved in nerve growth factor (NGF) induced neuronal apoptosis.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in brain and skeletal muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWKLVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH
Sequence Similarities: Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.Contains 1 protein kinase domain.Contains 1 SH3 domain.
Gene Name: MAP3K10 mitogen-activated protein kinase kinase kinase 10 [ Homo sapiens ]
Official Symbol: MAP3K10
Synonyms: MAP3K10; mitogen-activated protein kinase kinase kinase 10; MLK2; MEKK10; mixed lineage kinase 2; MKN28 derived nonreceptor_type serine/threonine kinase; MKN28 kinase; MST;
Gene ID: 4294
mRNA Refseq: NM_002446
Protein Refseq: NP_002437
MIM: 600137
Uniprot ID: Q02779
Chromosome Location: 19q13.2
Pathway: Insulin Signaling, organism-specific biosystem; p38 MAPK signaling pathway, organism-specific biosystem;
Function: ATP binding; JUN kinase kinase kinase activity; bHLH transcription factor binding; nucleotide binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.