"MAP4" Related Products

Expand
Expand
Expand

Recombinant Human MAP4

Cat.No.: MAP4-29752TH
Product Overview: Recombinant full length Human MAP4 (aa 1-99) with N-terminal proprietary tag, 36.96 kDa.
Description: The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 99 amino acids
Molecular Weight: 36.960kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA
Sequence Similarities: Contains 4 Tau/MAP repeats.
Gene Name: MAP4 microtubule-associated protein 4 [ Homo sapiens ]
Official Symbol: MAP4
Synonyms: MAP4; microtubule-associated protein 4;
Gene ID: 4134
mRNA Refseq: NM_001134364
Protein Refseq: NP_001127836
MIM: 157132
Uniprot ID: P27816
Chromosome Location: 3p21
Function: protein binding; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.