Recombinant Human MED16, His-tagged

• Cat.No.: MED16-31175TH
• Product Overview: Recombinant fragment, corresponding to amino acids 663-751 of Human THRAP5 isoform 4 with N terminal His tag; 89 amino acids, 25kDa.

Specification

• Description: Mediator of RNA polymerase II transcription subunit 16 is an enzyme that in humans is encoded by the MED16 gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 88 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PAWTGCQPATAWLAACSPSSPFVCSLAGRPRCLAVLPPCS STASPGPQASPRSTTCGGCTLALAPRRNARPAPGAAVS PCSSRPTEPRR

Gene Information

• Gene Name: MED16 mediator complex subunit 16 [ Homo sapiens ]
• Official Symbol: MED16
• Synonyms: MED16; mediator complex subunit 16; THRAP5, thyroid hormone receptor associated protein 5; mediator of RNA polymerase II transcription subunit 16; DRIP92; TRAP95
• Gene ID: 10025
• mRNA Refseq: NM_005481
• Protein Refseq: NP_005472
• MIM: 604062
• Uniprot ID: Q9Y2X0
• Chromosome Location: 19p13.3
• Pathway: Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem
• Function: receptor activity; thyroid hormone receptor binding; thyroid hormone receptor coactivator activity; transcription coactivator activity; transcription cofactor activity