Recombinant Human MED16, His-tagged
Cat.No. : | MED16-31175TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 663-751 of Human THRAP5 isoform 4 with N terminal His tag; 89 amino acids, 25kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 663-751 a.a. |
Description : | Mediator of RNA polymerase II transcription subunit 16 is an enzyme that in humans is encoded by the MED16 gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 88 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PAWTGCQPATAWLAACSPSSPFVCSLAGRPRCLAVLPPCS STASPGPQASPRSTTCGGCTLALAPRRNARPAPGAAVS PCSSRPTEPRR |
Gene Name | MED16 mediator complex subunit 16 [ Homo sapiens ] |
Official Symbol | MED16 |
Synonyms | MED16; mediator complex subunit 16; THRAP5, thyroid hormone receptor associated protein 5; mediator of RNA polymerase II transcription subunit 16; DRIP92; TRAP95; |
Gene ID | 10025 |
mRNA Refseq | NM_005481 |
Protein Refseq | NP_005472 |
MIM | 604062 |
Uniprot ID | Q9Y2X0 |
Chromosome Location | 19p13.3 |
Pathway | Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem; |
Function | receptor activity; thyroid hormone receptor binding; thyroid hormone receptor coactivator activity; transcription coactivator activity; transcription cofactor activity; |
◆ Recombinant Proteins | ||
MED16-31175TH | Recombinant Human MED16, His-tagged | +Inquiry |
MED16-11H | Recombinant Human MED16 protein, His-tagged | +Inquiry |
MED16-7886Z | Recombinant Zebrafish MED16 | +Inquiry |
MED16-4477H | Recombinant Human MED16 Protein, GST-tagged | +Inquiry |
MED16-6211HF | Recombinant Full Length Human MED16 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED16 Products
Required fields are marked with *
My Review for All MED16 Products
Required fields are marked with *