"MPI" Related Products

Expand
Expand

Recombinant Human MPI, His-tagged

Cat.No.: MPI-29812TH
Product Overview: Recombinant full length Human Mannose Phosphate Isomerase, isoform 2 with an N terminal His tag; 382aa, 41.9kDa.
Description: Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions.Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib.
Protein length: 362 amino acids
Conjugation: HIS
Molecular Weight: 41.900kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 2.4% Urea
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKTAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL
Sequence Similarities: Belongs to the mannose-6-phosphate isomerase type 1 family.
Gene Name: MPI mannose phosphate isomerase [ Homo sapiens ]
Official Symbol: MPI
Synonyms: MPI; mannose phosphate isomerase; mannose-6-phosphate isomerase; mannose 6 phosphate isomerase;
Gene ID: 4351
mRNA Refseq: NM_002435
Protein Refseq: NP_002426
MIM: 154550
Uniprot ID: P34949
Chromosome Location: 15q22-qter
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem;
Function: isomerase activity; mannose-6-phosphate isomerase activity; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.