Recombinant Human MPI, His-tagged

Cat.No. : MPI-29812TH
Product Overview : Recombinant full length Human Mannose Phosphate Isomerase, isoform 2 with an N terminal His tag; 382aa, 41.9kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 362 amino acids
Description : Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions.Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib.
Conjugation : HIS
Molecular Weight : 41.900kDa inclusive of tags
Tissue specificity : Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 2.4% Urea
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKTAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL
Sequence Similarities : Belongs to the mannose-6-phosphate isomerase type 1 family.
Gene Name MPI mannose phosphate isomerase [ Homo sapiens ]
Official Symbol MPI
Synonyms MPI; mannose phosphate isomerase; mannose-6-phosphate isomerase; mannose 6 phosphate isomerase;
Gene ID 4351
mRNA Refseq NM_002435
Protein Refseq NP_002426
MIM 154550
Uniprot ID P34949
Chromosome Location 15q22-qter
Pathway Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem;
Function isomerase activity; mannose-6-phosphate isomerase activity; metal ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MPI Products

Required fields are marked with *

My Review for All MPI Products

Required fields are marked with *

0
cart-icon