Recombinant Human MPI, His-tagged
Cat.No. : | MPI-29812TH |
Product Overview : | Recombinant full length Human Mannose Phosphate Isomerase, isoform 2 with an N terminal His tag; 382aa, 41.9kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 362 amino acids |
Description : | Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions.Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib. |
Conjugation : | HIS |
Molecular Weight : | 41.900kDa inclusive of tags |
Tissue specificity : | Expressed in all tissues, but more abundant in heart, brain and skeletal muscle. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 2.4% Urea |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKTAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL |
Sequence Similarities : | Belongs to the mannose-6-phosphate isomerase type 1 family. |
Gene Name | MPI mannose phosphate isomerase [ Homo sapiens ] |
Official Symbol | MPI |
Synonyms | MPI; mannose phosphate isomerase; mannose-6-phosphate isomerase; mannose 6 phosphate isomerase; |
Gene ID | 4351 |
mRNA Refseq | NM_002435 |
Protein Refseq | NP_002426 |
MIM | 154550 |
Uniprot ID | P34949 |
Chromosome Location | 15q22-qter |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; |
Function | isomerase activity; mannose-6-phosphate isomerase activity; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
MPI-1019H | Recombinant Human MPI, His-tagged | +Inquiry |
MPI-703C | Recombinant Cynomolgus MPI Protein, His-tagged | +Inquiry |
MPI-4591H | Recombinant Human MPI Protein (Ala2-Leu423), N-His tagged | +Inquiry |
MPI-5503H | Recombinant Human MPI Protein, GST-tagged | +Inquiry |
Mpi-454M | Recombinant Mouse Mpi Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPI-4235HCL | Recombinant Human MPI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPI Products
Required fields are marked with *
My Review for All MPI Products
Required fields are marked with *
0
Inquiry Basket