Recombinant Human MPI, His-tagged

• Cat.No.: MPI-29812TH
• Product Overview: Recombinant full length Human Mannose Phosphate Isomerase, isoform 2 with an N terminal His tag; 382aa, 41.9kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 362 amino acids
• Description: Phosphomannose isomerase catalyzes the interconversion of fructose-6-phosphate and mannose-6-phosphate and plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions.Mutations in the MPI gene were found in patients with carbohydrate-deficient glycoprotein syndrome, type Ib.
• Conjugation: HIS
• Molecular Weight: 41.900kDa inclusive of tags
• Tissue specificity: Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 2.4% Urea
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKTAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL
• Sequence Similarities: Belongs to the mannose-6-phosphate isomerase type 1 family.

Gene Information

• Gene Name: MPI mannose phosphate isomerase [ Homo sapiens ]
• Official Symbol: MPI
• Synonyms: MPI; mannose phosphate isomerase; mannose-6-phosphate isomerase; mannose 6 phosphate isomerase
• Gene ID: 4351
• mRNA Refseq: NM_002435
• Protein Refseq: NP_002426
• MIM: 154550
• Uniprot ID: P34949
• Chromosome Location: 15q22-qter
• Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Asparagine N-linked glycosylation, organism-specific biosystem; Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem
• Function: isomerase activity; mannose-6-phosphate isomerase activity; metal ion binding; zinc ion binding